PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_60079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 362aa    MW: 40686 Da    PI: 8.5766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_60079.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.7e-51131411128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                   l pGfrFhPtdeelv++yLkkk+++k++++ e i+++diyk++PwdLpk + + +e++wyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s+ 
  MLOC_60079.1  13 LLPGFRFHPTDEELVSFYLKKKIQQKPISI-ELIRQLDIYKFDPWDLPKlASTRGETDWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPIYSSe 108
                   579***************************.89***************525555788*************************************986 PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  MLOC_60079.1 109 DTRCIGLKKSLVFYKGRAARGIKTDWMMHEFRL 141
                   6777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5612173IPR003441NAC domain
PROSITE profilePS5100556.70413173IPR003441NAC domain
PfamPF023651.3E-2515141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESRNDVKSD EILLPGFRFH PTDEELVSFY LKKKIQQKPI SIELIRQLDI YKFDPWDLPK  60
LASTRGETDW YFYCPRDRKY RNSVRPNRVT AAGFWKATGT DRPIYSSEDT RCIGLKKSLV  120
FYKGRAARGI KTDWMMHEFR LPSLADTSLP KSRPIDKNIA LNDSWTICRI FKKTSSTVAQ  180
RALSHAWGAP SPGATEQHLL SAMQPMQTSH FALESSTCSL QVAAVAPSNQ FISFNGGPSP  240
QVLKGPTPTI LPFQTPLPSH KPVLRTTPPP FFFDAHFGQP EQITGFVTGS SADVNAGMSC  300
RDQESSTTKH GGNFRSLNNE REAPGRLDFP FDLVADSSND WECNIPWESF LSPTLPAEIS  360
QH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-491317717169NO APICAL MERISTEM PROTEIN
1ut4_B5e-491317717169NO APICAL MERISTEM PROTEIN
1ut7_A5e-491317717169NO APICAL MERISTEM PROTEIN
1ut7_B5e-491317717169NO APICAL MERISTEM PROTEIN
3ulx_A6e-4911763171Stress-induced transcription factor NAC1
4dul_A5e-491317717169NAC domain-containing protein 19
4dul_B5e-491317717169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_60079.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190499.10.0protein FEZ-like
SwissprotQ9ZVH05e-95FEZ_ARATH; Protein FEZ
TrEMBLM0XHJ70.0M0XHJ7_HORVV; Uncharacterized protein
STRINGMLOC_60079.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-97NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]