PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_57782.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

NF-YB

Protein Properties

Length: 249aa MW: 26135.8 Da PI: 6.7991

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_57782.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	178.8	4.9e-56	33	128	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdrflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv+plk+yl++yre+egek MLOC_57782.1 33 KEQDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEVYVAPLKAYLNRYREVEGEK 128 89********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.4E-51	29	136	IPR009072	Histone-fold
SuperFamily	SSF47113	3.88E-38	35	140	IPR009072	Histone-fold
Pfam	PF00808	6.2E-27	38	102	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.8E-18	66	84	No hit	No description
PROSITE pattern	PS00685	0	69	85	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.8E-18	85	103	No hit	No description
PRINTS	PR00615	5.8E-18	104	122	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MKSRKSYGQQ QSHLLSPVGS PSSDNGGGDS PAKEQDRFLP IANVSRIMKR SLPANAKISK 60 EAKETVQECV SEFISFVTGE ASDKCQREKR KTINGDDLLW AMTTLGFEVY VAPLKAYLNR 120 YREVEGEKAA VVGGSRHGDD DAHSSLSAGA DALAPPYPHG AGDRGVQDGD VGGHDAHVGL 180 MMGANVGFSP GTGTTFYAAQ GAAHGRRAYG GGEGARGIDF EGAFGGDRGK NGVGGEREFA 240 GHLHGAVQW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-46	33	123	2	92	Transcription factor HapC (Eurofung)
4g92_B	5e-46	33	123	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269\|PubMed:20566706, ECO:0000269\|PubMed:21148627}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_57782.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269\|PubMed:26542958}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB124648	1e-128	AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath.
GenBank	AB124649	1e-128	AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath.
GenBank	AY062182	1e-128	AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds.
GenBank	CP012616	1e-128	CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBank	CT837794	1e-128	CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence.
GenBank	KR815350	1e-128	KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBank	KR815351	1e-128	KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBank	LC016712	1e-128	LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong.
GenBank	LC016713	1e-128	LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3.
GenBank	LC016714	1e-128	LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha.
GenBank	LC016716	1e-128	LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai.
GenBank	LC016718	1e-128	LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba.
GenBank	LC016719	1e-128	LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe.
GenBank	LC016721	1e-128	LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020195900.1	1e-176	nuclear transcription factor Y subunit B-3-like
Swissprot	Q0J7P4	7e-73	HD5_ORYSJ; Nuclear transcription factor Y subunit B-11
TrEMBL	M0X822	0.0	M0X822_HORVV; Uncharacterized protein
STRING	MLOC_57782.1	0.0	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-62	nuclear factor Y, subunit B3

Publications ? help Back to Top
Yan WH, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice. Mol Plant, 2011. 4(2): p. 319-30 [PMID:21148627] Dai X, et al. LHD1, an allele of DTH8/Ghd8, controls late heading date in common wild rice (Oryza rufipogon). J Integr Plant Biol, 2012. 54(10): p. 790-9 [PMID:22963226] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958]