PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_57709.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 96aa MW: 10478.9 Da PI: 9.9654 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 72.2 | 9.8e-23 | 30 | 88 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+++++e++ ++e+isw e+g+sfvv+++ e+a+++Lp +Fkh nf+SFvRQLn+Y MLOC_57709.3 30 FLTKTHQMVEERGTDEVISWGEHGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTY 88 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.9E-25 | 25 | 88 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 6.53E-21 | 26 | 88 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.5E-19 | 26 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.9E-13 | 30 | 53 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 4.4E-19 | 30 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.9E-13 | 68 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.9E-13 | 81 | 93 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009408 | Biological Process | response to heat | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MAGAAAAQQQ QQKGGGGVVM KGGGGGPAPF LTKTHQMVEE RGTDEVISWG EHGRSFVVWK 60 PVELARDLLP LHFKHCNFSS FVRQLNTYVR NHPPPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 5e-15 | 23 | 88 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 5e-15 | 23 | 88 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_57709.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK365739 | 1e-157 | AK365739.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2037B11. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020177659.1 | 3e-42 | heat stress transcription factor B-1-like | ||||
Swissprot | Q67TP9 | 7e-36 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
TrEMBL | M0X7S9 | 2e-65 | M0X7S9_HORVV; Uncharacterized protein | ||||
STRING | MLOC_57709.1 | 6e-58 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36990.1 | 2e-27 | heat shock factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|