PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_57700.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 266aa MW: 30345.3 Da PI: 9.7148 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.5 | 2.7e-31 | 43 | 93 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+ MLOC_57700.1 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 93 79***********************************************95 PP | |||||||
2 | K-box | 102.8 | 4.4e-34 | 110 | 207 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +ss ++e +a+++qqe+akL+++i +Lq+++R l+G+ + ++s+++L+qLe +L+k+l kiR++Knell ++ie++q++e elq++n +Lr+k++ MLOC_57700.1 110 TSSAGTVAEINAQHYQQESAKLRQQITTLQNSNRTLIGDTMATMSHRDLKQLEGRLDKGLGKIRARKNELLSAEIEYMQRREMELQNNNFYLREKVA 206 4455559999*************************************************************************************98 PP K-box 100 e 100 e MLOC_57700.1 207 E 207 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.711 | 35 | 95 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-41 | 35 | 94 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.54E-44 | 36 | 112 | No hit | No description |
SuperFamily | SSF55455 | 1.57E-32 | 36 | 107 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 37 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-32 | 37 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 44 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-32 | 57 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-32 | 72 | 93 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.5E-25 | 120 | 205 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.868 | 121 | 211 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MQILNEKLAT PSTGLMVKES VSPGLGSAGA AAEKMGRGRI EIKRIENTTN RQVTFCKRRN 60 GLLKKAYELS VLCDAEVALV VFSSRGRLYE YSNNSVKATI ERYKKATSDT SSAGTVAEIN 120 AQHYQQESAK LRQQITTLQN SNRTLIGDTM ATMSHRDLKQ LEGRLDKGLG KIRARKNELL 180 SAEIEYMQRR EMELQNNNFY LREKVAETER GQQQTLNMMG AASTSNEYEQ NMIQCDPRTF 240 LQFNIMQQPQ YYTQQEDRKT FNSVER |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_57700.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK375322 | 0.0 | AK375322.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3091A04. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020176048.1 | 1e-164 | MADS-box transcription factor 58-like isoform X2 | ||||
Swissprot | Q2V0P1 | 1e-144 | MAD58_ORYSJ; MADS-box transcription factor 58 | ||||
TrEMBL | F2EGP5 | 0.0 | F2EGP5_HORVV; Predicted protein | ||||
STRING | MLOC_57700.1 | 0.0 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP649 | 37 | 144 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 2e-98 | MIKC_MADS family protein |