PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_56761.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 200aa MW: 21856.9 Da PI: 8.48 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 49.1 | 1.2e-15 | 6 | 35 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 +AtPktil++m+vkgLtl h+kSHLQkYR+ MLOC_56761.2 6 EATPKTILRTMGVKGLTLFHLKSHLQKYRM 35 7****************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 3.0E-10 | 5 | 36 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 8.1E-14 | 6 | 36 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.7E-5 | 6 | 36 | IPR009057 | Homeodomain-like |
Pfam | PF14379 | 4.6E-20 | 76 | 121 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010628 | Biological Process | positive regulation of gene expression | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MTALAEATPK TILRTMGVKG LTLFHLKSHL QKYRMGKQTG KETPEQSKDG SYLLDAQGGM 60 SLSPRVSTQD AKESQEVKEA LRAQMEMQRS LHEQVEVQKH VDIRMDAYTT YINTLLEKAC 120 KIVSEQFASS GFSVSDQSLP ELSSGGVMCG TATDALSSSV FHQLSVSSIN MHSPGGKPSP 180 SGMEGQLLLQ RSPEFKRKSC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00378 | DAP | Transfer from AT3G24120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_56761.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363665 | 0.0 | AK363665.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017P09. | |||
GenBank | AK367354 | 0.0 | AK367354.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2055J10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020195363.1 | 1e-138 | protein PHR1-LIKE 2-like isoform X2 | ||||
Refseq | XP_020195364.1 | 1e-138 | protein PHR1-LIKE 2-like isoform X2 | ||||
Refseq | XP_020195365.1 | 1e-138 | protein PHR1-LIKE 2-like isoform X2 | ||||
Refseq | XP_020195366.1 | 1e-138 | protein PHR1-LIKE 2-like isoform X2 | ||||
Refseq | XP_020195367.1 | 1e-138 | protein PHR1-LIKE 2-like isoform X2 | ||||
Swissprot | Q8LAJ7 | 2e-41 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
Swissprot | Q94A57 | 3e-41 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
TrEMBL | A0A446T1N6 | 1e-142 | A0A446T1N6_TRITD; Uncharacterized protein | ||||
STRING | Traes_5AL_0684A2454.1 | 1e-140 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13640.1 | 1e-43 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|