PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_56103.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 147aa MW: 17339.7 Da PI: 9.265 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 183.4 | 5.5e-57 | 7 | 136 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL++ k+ e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ MLOC_56103.4 7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKPIYT 102 69****************************.9***************952433333556************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129 ++ lvg++ktLvfykgrap+g+k+dW+mheyrle MLOC_56103.4 103 -NHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136 .999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.03E-58 | 5 | 142 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.246 | 7 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-29 | 8 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQEKCKIGM 60 EEQNDWYFFS HKDKKYPTGT RTNRATSAGF WKATGRDKPI YTNHCLVGMR KTLVFYKGRA 120 PNGQKSDWIM HEYRLETNEN GATPVRN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-51 | 6 | 135 | 14 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00136 | DAP | Transfer from AT1G12260 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_56103.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ693424 | 1e-146 | JQ693424.1 Brachypodium distachyon SWN3 (SWN3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020155213.1 | 1e-104 | NAC domain-containing protein 7-like | ||||
Refseq | XP_020155215.1 | 1e-104 | NAC domain-containing protein 7-like | ||||
Swissprot | Q9FWX2 | 2e-92 | NAC7_ARATH; NAC domain-containing protein 7 | ||||
TrEMBL | M0X0R2 | 1e-107 | M0X0R2_HORVV; Uncharacterized protein | ||||
STRING | MLOC_56103.2 | 1e-104 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G12260.1 | 4e-83 | NAC 007 |
Publications ? help Back to Top | |||
---|---|---|---|
|