![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_49381.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 109aa MW: 11812.5 Da PI: 11.955 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 119.5 | 4e-37 | 9 | 93 | 6 | 91 |
TCP 6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 r+ ++hTkv+gR+RR+R++a caar+F+L++eLG+++d++t+ WLlqq++pai ++tgt++ +a ++ +++ + ++ss++a+ MLOC_49381.1 9 PRNRDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETVRWLLQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTQSSSSAS 93 6999********************************************************77777333.33333333322222221 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 6.9E-31 | 11 | 91 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 26.932 | 11 | 65 | IPR017887 | Transcription factor TCP subgroup |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008361 | Biological Process | regulation of cell size | ||||
GO:0048364 | Biological Process | root development | ||||
GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MAVVRKPPPR NRDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET VRWLLQQSEP 60 AIVAATGTGT VPAIATTVDG VLRIPTQSSS SASSAVVDDD ASAKRRRKL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}. | |||||
UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00638 | PBM | Transfer from Lj0g3v0004489 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_49381.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020148818.1 | 8e-65 | transcription factor PCF2-like | ||||
Swissprot | A2YXQ1 | 1e-59 | PCF2_ORYSI; Transcription factor PCF2 | ||||
Swissprot | Q6ZBH6 | 1e-59 | PCF2_ORYSJ; Transcription factor PCF2 | ||||
TrEMBL | A0A287SWJ0 | 9e-69 | A0A287SWJ0_HORVV; Uncharacterized protein | ||||
STRING | MLOC_49381.1 | 2e-72 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3912 | 31 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51910.2 | 2e-43 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|