PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_34098.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 108aa MW: 11760.4 Da PI: 10.5239 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 121.1 | 4e-38 | 5 | 59 | 5 | 59 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvP+G+grrkn+ MLOC_34098.1 5 PLPCPRCRSRETKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPIGAGRRKNR 59 579**************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 1.5E-31 | 5 | 59 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.556 | 6 | 60 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 2.0E-25 | 6 | 59 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 8 | 44 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
AGAAPLPCPR CRSRETKFCY FNNYNVNQPR HFCKACHRYW TAGGALRNVP IGAGRRKNRP 60 LGPIATVAGH HHRAAAGFVL GFPSPSSSPT SPPPVYADRW ELGPDPPL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_34098.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ969263 | 1e-169 | AJ969263.1 Hordeum vulgare dof17 gene for dof zinc finger protein 17, cultivated variety Bomi. | |||
GenBank | AK365055 | 1e-169 | AK365055.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030J14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188982.1 | 2e-55 | dof zinc finger protein DOF1.5-like | ||||
Swissprot | Q5JLR7 | 3e-44 | DOF5_ORYSJ; Dof zinc finger protein 5 | ||||
TrEMBL | A0A287LMC3 | 1e-60 | A0A287LMC3_HORVV; Uncharacterized protein | ||||
STRING | MLOC_34098.1 | 2e-73 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6495 | 28 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 2e-34 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|