PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_22013.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 234aa MW: 25788.3 Da PI: 4.9007 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 34.2 | 5.4e-11 | 74 | 125 | 4 | 55 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +k+ rr ++NR +A +sR+RKk +++ Le+k+k Leae ++L l+ e MLOC_22013.1 74 SKKKRRQMRNRDSAMKSRERKKSYVKDLETKSKYLEAECRRLSYALQCCAAE 125 699************************************9998777665555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.4E-6 | 70 | 135 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.737 | 73 | 115 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 8.44E-11 | 75 | 133 | No hit | No description |
Pfam | PF00170 | 7.1E-10 | 75 | 131 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.9E-12 | 75 | 134 | No hit | No description |
CDD | cd14704 | 1.05E-13 | 76 | 127 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 78 | 93 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0030968 | Biological Process | endoplasmic reticulum unfolded protein response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005789 | Cellular Component | endoplasmic reticulum membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MQEEEAAGVE PVDGISVDEF IDALFDGAEE GGEKGNGSEA EAGGSTDGDS RRGDEEGVEV 60 VTPETEVDGD DPISKKKRRQ MRNRDSAMKS RERKKSYVKD LETKSKYLEA ECRRLSYALQ 120 CCAAENMALR QNMLKDRPIG AHTVMQESAV LMETLPLVSL LCLVSIVCLF LTPGLPNRSL 180 VAPRRAERDL AMVAGKPSSD QPETLELLLH GRRWRGTRER IKLDILPLRA AAAC |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 74 | 78 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00019 | PBM | Transfer from AT1G42990 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_22013.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK365505 | 0.0 | AK365505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034K24. | |||
GenBank | AK369957 | 0.0 | AK369957.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2101P04. | |||
GenBank | AK370149 | 0.0 | AK370149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2105L10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020184631.1 | 1e-157 | bZIP transcription factor 50 | ||||
Swissprot | Q69XV0 | 1e-89 | BZP50_ORYSJ; bZIP transcription factor 50 | ||||
TrEMBL | F2DNN7 | 1e-168 | F2DNN7_HORVV; Predicted protein | ||||
STRING | MLOC_22013.1 | 1e-169 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6934 | 37 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 4e-14 | basic region/leucine zipper motif 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|