PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_21581.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 102aa MW: 11617.4 Da PI: 10.3208 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.1 | 4.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++lv +++++G g W + +++ g++R++k+c++rw++yl MLOC_21581.1 14 RGAWTAMEDDILVSYINEHGEGKWGSLPKRAGLNRCGKSCRLRWLNYL 61 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 36.7 | 9.7e-12 | 67 | 102 | 1 | 38 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 rg+ + +E+el+v+++++lG++ W++Ia +++ gRt+k MLOC_21581.1 67 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDK 102 7899******************.*********.***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.078 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.39E-25 | 12 | 101 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.1E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.21E-10 | 16 | 61 | No hit | No description |
SMART | SM00717 | 0.49 | 66 | 102 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 15.737 | 66 | 102 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.4E-9 | 67 | 102 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-16 | 69 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.09E-6 | 71 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MGRKPCCSKE GLNRGAWTAM EDDILVSYIN EHGEGKWGSL PKRAGLNRCG KSCRLRWLNY 60 LRPGIKRGNI SDDEEELIVR LHRLLGNRWS LIAGRLPGRT DK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-21 | 12 | 101 | 25 | 113 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_21581.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | D88619 | 2e-91 | D88619.1 Oryza sativa mRNA for OSMYB3, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003561552.1 | 3e-65 | transcription repressor MYB6 | ||||
Swissprot | P10290 | 6e-53 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A287MI07 | 2e-65 | A0A287MI07_HORVV; Uncharacterized protein | ||||
TrEMBL | G9MA83 | 3e-65 | G9MA83_HORVV; Myb-related protein | ||||
STRING | MLOC_21581.1 | 8e-68 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16720.1 | 1e-51 | myb domain protein 7 |