PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_20442.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 138aa MW: 14753.5 Da PI: 7.4536 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 60.8 | 2.6e-19 | 1 | 35 | 26 | 60 |
zf-Dof 26 lsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++qPr++C++CrryWt+GG+lr vPvGg++r++ MLOC_20442.2 1 MAQPRHYCRTCRRYWTHGGTLRKVPVGGACRRSSG 35 58*****************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-9 | 1 | 30 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 17.439 | 1 | 35 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 8.3E-16 | 2 | 34 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MAQPRHYCRT CRRYWTHGGT LRKVPVGGAC RRSSGNSNKR RRPSAEPHTP SSDSPQPDQL 60 DTLPPFPVFP FLTDGGPVFL PQFDLGLGGF PWTAPPATDH LYDGLAAPSG GCDGALTPAG 120 AWDDLGGLDF TWPPPAGN |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_20442.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK375024 | 0.0 | AK375024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3083K20. | |||
GenBank | AK375174 | 0.0 | AK375174.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3087B14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186822.1 | 2e-60 | dof zinc finger protein DOF1.7-like | ||||
TrEMBL | A0A287JMX4 | 5e-96 | A0A287JMX4_HORVV; Uncharacterized protein | ||||
TrEMBL | A0A287JN29 | 5e-96 | A0A287JN29_HORVV; Uncharacterized protein | ||||
STRING | MLOC_20442.1 | 6e-95 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60850.1 | 2e-12 | OBF binding protein 4 |