PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_19052.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 143aa MW: 16582.6 Da PI: 10.2847 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.7 | 4.9e-17 | 22 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l+ ++++G tW+++a+ g++R++k+c++rw +yl MLOC_19052.2 22 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69 678*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.914 | 17 | 73 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-12 | 21 | 71 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-20 | 21 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.9E-15 | 22 | 69 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.38E-20 | 24 | 98 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.10E-9 | 25 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-7 | 69 | 100 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MVEKPASQAN AGGDVEARKE RKGLWSPEED ERLYTRITRH GVSTWSSVAQ LAGLRRSGKS 60 CRLRWMNYLR PDLKKEPISK REEETIISLQ KSLGNRYQVV GDCREDAGED GQRDQELLEL 120 PHQEASEHQR RRREGRRRTR KAG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-12 | 22 | 97 | 27 | 101 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_19052.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-128 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020183575.1 | 1e-60 | myb-related protein 305-like | ||||
Swissprot | P20027 | 5e-32 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | M0V641 | 3e-62 | M0V641_HORVV; Uncharacterized protein | ||||
STRING | MLOC_19052.1 | 5e-63 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 1e-32 | myb domain protein 86 |