PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_18177.6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 137aa MW: 15584.8 Da PI: 10.4784 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.9 | 2.6e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+lv++++ +G g+W++++r g+ R++k+c++rw +yl MLOC_18177.6 14 RGLWSPEEDEKLVKYITAHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61 789*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.2 | 7.8e-18 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k++w++ MLOC_18177.6 67 RGSFSQEEEALIVELHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-27 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.594 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.7E-30 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.20E-10 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.157 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.0E-27 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.0E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-16 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.33E-11 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT AHGHGCWSSV PRQAGLQRCG KSCRLRWINY 60 LRPDLKRGSF SQEEEALIVE LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA 120 VGSLHSGNIP SSAGNWS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-32 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_18177.6 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK372926 | 0.0 | AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020185977.1 | 1e-94 | transcription factor MYB86-like isoform X1 | ||||
Swissprot | Q9SPG3 | 2e-72 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A446PVU6 | 1e-95 | A0A446PVU6_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453F950 | 1e-95 | A0A453F950_AEGTS; Uncharacterized protein | ||||
TrEMBL | M7YTQ9 | 1e-95 | M7YTQ9_TRIUA; Transcription factor MYB86 | ||||
STRING | MLOC_18177.2 | 2e-94 | (Hordeum vulgare) | ||||
STRING | TRIUR3_25230-P1 | 2e-96 | (Triticum urartu) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13890.2 | 6e-78 | myb domain protein 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|