PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_16037.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 133aa MW: 14839 Da PI: 10.6791 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2.1e-17 | 31 | 78 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEde l++ v++ G g+W+t +r+ g+ R++k+c++rw +yl MLOC_16037.4 31 RGPWTAEEDEVLARFVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 78 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.522 | 26 | 82 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-20 | 27 | 80 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-12 | 30 | 80 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.1E-15 | 31 | 78 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.47E-22 | 32 | 107 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.53E-10 | 33 | 78 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.9E-7 | 81 | 105 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0010468 | Biological Process | regulation of gene expression | ||||
GO:0048354 | Biological Process | mucilage biosynthetic process involved in seed coat development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MARRKPPAQH GGARSEDGQA QTTTAPPPLK RGPWTAEEDE VLARFVAREG EGRWRTLPRR 60 AGLLRCGKSC RLRWMNYLRP DIKRGPIAED EEDLILRLHR VLGNRCVHVT YSLKCVHADG 120 GADGRVAVHA GGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-16 | 27 | 113 | 3 | 88 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_16037.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK376562 | 1e-172 | AK376562.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3127N16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181361.1 | 1e-62 | transcription repressor MYB5-like | ||||
Swissprot | Q38850 | 7e-41 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A446PWN1 | 4e-77 | A0A446PWN1_TRITD; Uncharacterized protein | ||||
STRING | MLOC_16037.3 | 1e-69 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 3e-43 | myb domain protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|