PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_14305.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | LFY | ||||||||
Protein Properties | Length: 138aa MW: 15160.4 Da PI: 10.7511 | ||||||||
Description | LFY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FLO_LFY | 190.4 | 1.3e-58 | 7 | 138 | 177 | 303 |
FLO_LFY 177 ee.kkseeekkkaskkkqkrkkkkelkse....ededeee....eededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLl 264 + +k+ + +ka kk++rkk ++l+ e +e+ +e+++++ +g g erqrehPf+vtepgevar+kknGLDYLf+Lye+Cr Ll MLOC_14305.3 7 GKkQKNGSAGRKA--KKARRKKVNDLRLGmqgdE--HEDGggglSESTESSAGGGVGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEECRVLLL 99 2212233333333..3444455444444343331..2222112144555556778889*************************************** PP FLO_LFY 265 qvqkiakerGekcPtkvtnqvfryakkagasyinkPkmr 303 qvq++ak +G+k+Ptkvtnqvfrya k+gasyinkPkmr MLOC_14305.3 100 QVQSMAKLHGQKAPTKVTNQVFRYASKVGASYINKPKMR 138 **************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF01698 | 4.6E-61 | 6 | 138 | IPR002910 | Floricaula/leafy protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0031490 | Molecular Function | chromatin DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0043621 | Molecular Function | protein self-association |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MRMMASGKKQ KNGSAGRKAK KARRKKVNDL RLGMQGDEHE DGGGGLSEST ESSAGGGVGG 60 ERQREHPFVV TEPGEVARAK KNGLDYLFHL YEECRVLLLQ VQSMAKLHGQ KAPTKVTNQV 120 FRYASKVGAS YINKPKMR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2vy1_A | 6e-44 | 58 | 138 | 1 | 81 | PROTEIN LEAFY |
2vy2_A | 6e-44 | 58 | 138 | 1 | 81 | PROTEIN LEAFY |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}. | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00095 | SELEX | Transfer from AT5G61850 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_14305.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB231888 | 0.0 | AB231888.1 Triticum aestivum WFLa mRNA for FLORICAULA/LEAFY-like protein, complete cds. | |||
GenBank | AB231890 | 0.0 | AB231890.1 Triticum aestivum WFLd mRNA for FLORICAULA/LFAFY-like protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020152169.1 | 3e-70 | probable transcription factor FL | ||||
Swissprot | A2XX39 | 2e-60 | FL_ORYSI; Probable transcription factor FL | ||||
Swissprot | Q0JAI1 | 2e-60 | FL_ORYSJ; Probable transcription factor FL | ||||
TrEMBL | A0A287J8D9 | 4e-95 | A0A287J8D9_HORVV; Uncharacterized protein | ||||
STRING | MLOC_14305.1 | 2e-94 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61850.1 | 2e-42 | floral meristem identity control protein LEAFY (LFY) |