PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_11586.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 193aa MW: 21659.7 Da PI: 9.2618 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 193.5 | 3.1e-60 | 18 | 156 | 1 | 139 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkve 97 s+yk+kaal +++ p+f+ l+sg+ k+ ++G++ll++a+a+++r+ydW +kq+f+ls+ e+++l+ l+ +sceffhdp+++ s+eGkvrk+lkve MLOC_11586.1 18 SIYKGKAALAFDPRPPQFVPLESGAYKVAKEGFVLLQFAPAVGPRQYDWARKQVFSLSVWEMGTLLTLGLTDSCEFFHDPFKGRSDEGKVRKVLKVE 114 7************************************************************************************************ PP Whirly 98 PlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 P pdG G f+nlsv+n l++++e++++P++k+e+av+ s ++ MLOC_11586.1 115 PTPDGNGRFFNLSVQNRLLNVDENIYIPITKGEYAVIVSTFN 156 *************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.1E-78 | 8 | 178 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.02E-74 | 11 | 193 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 8.2E-59 | 19 | 153 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
GGPPVPGGQA GRVFASYSIY KGKAALAFDP RPPQFVPLES GAYKVAKEGF VLLQFAPAVG 60 PRQYDWARKQ VFSLSVWEMG TLLTLGLTDS CEFFHDPFKG RSDEGKVRKV LKVEPTPDGN 120 GRFFNLSVQN RLLNVDENIY IPITKGEYAV IVSTFNYIIP HIMGWSTFTN SIKPEESQPY 180 NRPQSSPELE WRR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 2e-91 | 7 | 191 | 32 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 2e-91 | 7 | 191 | 32 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 2e-91 | 7 | 191 | 32 | 218 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 2e-91 | 7 | 191 | 32 | 218 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_11586.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353795 | 0.0 | AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22. | |||
GenBank | AK365452 | 0.0 | AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186783.1 | 1e-139 | single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Swissprot | B2LXS7 | 1e-120 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | F2CQ93 | 1e-138 | F2CQ93_HORVV; Predicted protein | ||||
STRING | MLOC_11586.1 | 1e-141 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3012 | 38 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02740.2 | 2e-94 | ssDNA-binding transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|