PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_11474.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 104aa MW: 11826 Da PI: 10.6231 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 70.4 | 1.6e-22 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 + en+s rqvt+skRr gilKKA+ELS+LCd++ +++fs++g+ MLOC_11474.4 10 KLENSSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 53 679**************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.2E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 24.6 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-26 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-18 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.5E-20 | 11 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-18 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-18 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGRVKLKIKK LENSSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGRPTICIGD 60 KSPIDEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_B | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_C | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_D | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_11474.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK373111 | 1e-174 | AK373111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021H04. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192405.1 | 6e-64 | agamous-like MADS-box protein AGL65 | ||||
Swissprot | Q7X9I0 | 3e-50 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
TrEMBL | A0A287NR03 | 2e-68 | A0A287NR03_HORVV; Uncharacterized protein | ||||
STRING | MLOC_11474.1 | 1e-66 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18750.1 | 5e-42 | AGAMOUS-like 65 |
Publications ? help Back to Top | |||
---|---|---|---|
|