PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_11286.3
Organism
Hordeum vulgare
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HSF
Protein Properties Length: 80aa    MW: 8986.17 Da    PI: 6.5128
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_11286.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.52.5e-251573260
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                  Fl k+ye++ed+++++++sw   g sfvv+++ +f++++LpkyFkh+nf+SF+RQLn+Y
  MLOC_11286.3 15 FLIKTYEMVEDPATSRVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSSFIRQLNTY 73
                  9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.9E-28674IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.81E-241174IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.8E-231180IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.8E-211573IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.3E-161538IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.3E-165365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.3E-166678IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MEMEGGSQGA SPAPFLIKTY EMVEDPATSR VVSWGPGGAS FVVWNPPDFS RDLLPKYFKH  60
NNFSSFIRQL NTYVSSIFIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B4e-186801994Heat shock factor protein 1
5d5v_B4e-186801994Heat shock factor protein 1
5d5v_D4e-186801994Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_11286.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:12032317}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3623151e-119AK362315.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2004D11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168481.11e-40heat stress transcription factor A-4d-like
SwissprotQ93VB53e-33HFA4D_ORYSJ; Heat stress transcription factor A-4d
TrEMBLF2DEJ83e-45F2DEJ8_HORVV; Predicted protein
STRINGMLOC_11286.14e-46(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.12e-32heat shock transcription factor B4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Kojo K, et al.
    Regulatory mechanisms of ROI generation are affected by rice spl mutations.
    Plant Cell Physiol., 2006. 47(8): p. 1035-44
    [PMID:16816407]