PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_10280.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 194aa MW: 21864.6 Da PI: 10.1383 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.6 | 9.1e-16 | 93 | 137 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++++ kqlG+g+W+ I++ + ++Rt+ q+ s+ qky MLOC_10280.3 93 PWTEEEHRKFLEGLKQLGKGDWRGISKNFVTTRTATQVASHAQKY 137 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.744 | 86 | 142 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.0E-18 | 87 | 142 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.7E-19 | 89 | 141 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.7E-11 | 90 | 140 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-12 | 91 | 136 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.97E-11 | 93 | 138 | No hit | No description |
Pfam | PF00249 | 4.6E-13 | 93 | 137 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MEEEGGARKA VLFRLFGVEV RGAEEEEEDD AEPMELKKST SMPNLASIGP ILPRGEASAS 60 HDKGYASDDG ELASTPQLKR RRRKAQERKK GIPWTEEEHR KFLEGLKQLG KGDWRGISKN 120 FVTTRTATQV ASHAQKYFLR QTNPGKKKRR ASLFDVGIPA GHGYDDQVLD PVQSSSRQVN 180 QNIHRIQHLT YALR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 83 | KRRRRK |
2 | 78 | 89 | KRRRRKAQERKK |
3 | 79 | 89 | RRRRKAQERKK |
4 | 145 | 149 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_10280.3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK251610 | 0.0 | AK251610.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf129a20, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181078.1 | 1e-103 | transcription factor DIVARICATA-like | ||||
Swissprot | B8BI93 | 4e-60 | MYBS2_ORYSI; Transcription factor MYBS2 | ||||
Swissprot | Q7XC51 | 4e-60 | MYBS2_ORYSJ; Transcription factor MYBS2 | ||||
TrEMBL | M0UES9 | 1e-141 | M0UES9_HORVV; Uncharacterized protein | ||||
STRING | MLOC_10280.2 | 1e-120 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 9e-33 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|