PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G041830.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 165aa MW: 19105.6 Da PI: 9.4209 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.4 | 1.3e-32 | 87 | 145 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ HL.SW.v1.0.G041830.1 87 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 145 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.4E-34 | 72 | 145 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.89E-29 | 79 | 146 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.344 | 82 | 147 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.8E-37 | 87 | 146 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.8E-25 | 88 | 144 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MASTSQAMLN QGLFEDQEAP ALSWGEVNDC LGSKRSSIIS GGELDHQYHD HHRHIGVSTM 60 KMKKIKGRRK VREPRFCFKT MSEVDVLDDG YKWRKYGQKV VKNTQHPRSY YRCTQDNCRV 120 KKRVERLAED PRMVITTYEG RHVHSPSHDL EDSHAPSPLS NFFW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-28 | 78 | 144 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 9e-28 | 78 | 144 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP229759 | 1e-105 | KP229759.1 UNVERIFIED: Boehmeria nivea WRKY transcription factor-like (WRKY30) mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002279024.1 | 2e-80 | PREDICTED: probable WRKY transcription factor 13 isoform X1 | ||||
Swissprot | Q9SVB7 | 3e-63 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A2P5ABG7 | 3e-95 | A0A2P5ABG7_PARAD; WRKY domain containing protein | ||||
STRING | VIT_07s0031g01840.t01 | 6e-80 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4079 | 33 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 1e-65 | WRKY DNA-binding protein 13 |