PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G040909.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 123aa MW: 14648.9 Da PI: 10.2245 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.9 | 9.4e-10 | 62 | 96 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp+++++ +LA+ +gL+++q+ +WF N+R ++ HL.SW.v1.0.G040909.1 62 RWPYPTETDKIHLAELTGLDQKQINNWFINQRKRH 96 569*****************************985 PP | |||||||
2 | ELK | 39.2 | 1.5e-13 | 16 | 37 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKYsgy+++Lk+EFs HL.SW.v1.0.G040909.1 16 ELKDKLLRKYSGYISTLKHEFS 37 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 10.772 | 16 | 36 | IPR005539 | ELK domain |
SMART | SM01188 | 8.9E-8 | 16 | 37 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.1E-11 | 16 | 37 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.357 | 36 | 99 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.75E-20 | 37 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 5.7E-11 | 38 | 103 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-28 | 41 | 100 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 1.4E-16 | 56 | 95 | IPR008422 | Homeobox KN domain |
CDD | cd00086 | 3.34E-10 | 62 | 99 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 74 | 97 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MEGGDTLRMI TQEDRELKDK LLRKYSGYIS TLKHEFSKKK KKGKLPKQAR QILLDWWSLH 60 YRWPYPTETD KIHLAELTGL DQKQINNWFI NQRKRHWKPP ENMQVAIMEA HSLYGSSICH 120 NQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010109305.1 | 2e-60 | homeobox protein knotted-1-like 4 | ||||
Swissprot | Q84JS6 | 2e-46 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A2P5DG04 | 2e-69 | A0A2P5DG04_PARAD; Octamer-binding transcription factor | ||||
STRING | XP_010109305.1 | 9e-60 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 2e-42 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|