PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G036695.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 132aa MW: 14692 Da PI: 10.1305 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.6 | 1.7e-18 | 66 | 100 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+C + kTp+WR gp g+ktLCnaCG++y++ +l HL.SW.v1.0.G036695.1 66 CSHCLSQKTPQWRAGPLGPKTLCNACGVRYKSGRL 100 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 8.6E-16 | 60 | 114 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.121 | 63 | 96 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.2E-14 | 64 | 98 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 2.38E-15 | 64 | 124 | No hit | No description |
CDD | cd00202 | 1.73E-13 | 65 | 112 | No hit | No description |
Pfam | PF00320 | 2.5E-16 | 66 | 100 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 66 | 91 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MAKKTTTTTT SYYDYPPLLQ QAYWLADSEL IVPKKEVGKE KVKENGDLVK EQPLGLVAHG 60 LVARRCSHCL SQKTPQWRAG PLGPKTLCNA CGVRYKSGRL LPEYRPAKSP TFVSYLHSNS 120 HKKVMEMRNG S* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019432694.1 | 6e-56 | PREDICTED: GATA transcription factor 5-like isoform X1 | ||||
Refseq | XP_019432695.1 | 6e-56 | PREDICTED: GATA transcription factor 5-like isoform X2 | ||||
Swissprot | O82632 | 2e-36 | GATA9_ARATH; GATA transcription factor 9 | ||||
TrEMBL | A0A2P5DHI0 | 3e-57 | A0A2P5DHI0_TREOI; GATA transcription factor | ||||
STRING | AES80829 | 5e-54 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8487 | 24 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60530.1 | 8e-38 | GATA transcription factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|