PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G033492.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18380.7 Da PI: 10.1201 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.2 | 5.2e-31 | 75 | 133 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+ +fprsYY+Ct++gC+vkk+++r +d+ vv++tYeg Hnh+ HL.SW.v1.0.G033492.1 75 LDDGYRWRKYGQKTVKNGRFPRSYYKCTYQGCNVKKQIQRLCKDEGVVVTTYEGMHNHS 133 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.4E-32 | 60 | 133 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.14E-28 | 67 | 133 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.598 | 70 | 135 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-34 | 75 | 134 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-24 | 76 | 132 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MENYQLMPSL LSSSDMGSAR LNNKNKVGTE STGTSYDKNL SEKNRKMMKS SPKQGLAEVK 60 RHKFAFQTRS QVDVLDDGYR WRKYGQKTVK NGRFPRSYYK CTYQGCNVKK QIQRLCKDEG 120 VVVTTYEGMH NHSSDDHKYN ENFDHILRRM QTSYANAL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-28 | 65 | 132 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-28 | 65 | 132 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG983334 | 0.0 | HG983334.1 Humulus lupulus mRNA for WRKY transcription factor (Wrky5 gene), cultivar Osvald's 72, clone 4201. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010086980.2 | 2e-55 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 6e-43 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0D6DR35 | 3e-98 | A0A0D6DR35_HUMLU; WRKY transcription factor | ||||
STRING | XP_010086980.1 | 6e-55 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 2e-45 | WRKY DNA-binding protein 75 |