 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | HL.SW.v1.0.G029311.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 89aa MW: 10392.2 Da PI: 10.5862 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.6 | 1.8e-29 | 31 | 81 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien +nrqvtfskRr g+lKKA EL vLCd+ev +iifs++g+lye+s+
HL.SW.v1.0.G029311.1 31 KRIENATNRQVTFSKRRSGLLKKARELAVLCDVEVGLIIFSQKGRLYEFST 81
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.3E-39 | 23 | 82 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.525 | 23 | 83 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.1E-30 | 25 | 45 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.37E-37 | 25 | 86 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 25 | 79 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.53E-28 | 25 | 85 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.4E-26 | 32 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.1E-30 | 45 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.1E-30 | 60 | 81 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
METMEKWMNK ASKMEVLWSR INMVRGKIQM KRIENATNRQ VTFSKRRSGL LKKARELAVL 60 CDVEVGLIIF SQKGRLYEFS TTEYDQSQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-19 | 23 | 86 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024028270.1 | 5e-33 | MADS-box protein AGL42-like isoform X1 | ||||
| Refseq | XP_024028271.1 | 5e-33 | MADS-box protein AGL42-like isoform X1 | ||||
| Swissprot | Q9FIS1 | 2e-28 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A2P5ERB0 | 6e-31 | A0A2P5ERB0_TREOI; MADS-box transcription factor | ||||
| STRING | EMJ22338 | 4e-30 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 7e-31 | AGAMOUS-like 42 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|