PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G022049.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 175aa MW: 19946.9 Da PI: 5.9473 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.2 | 1.2e-31 | 113 | 171 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ gCpvkk+ver++edp +v++tYeg Hnh+ HL.SW.v1.0.G022049.1 113 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVDGCPVKKRVERDREDPMYVITTYEGVHNHQ 171 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 99 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-28 | 106 | 171 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.285 | 108 | 173 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.3E-37 | 113 | 172 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.9E-25 | 114 | 171 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MMSGSPSSNS NTKFKSHMDQ SPENDNMVDD SSLDQFSEFL MFEEWPDEYR HQEVSPVSQP 60 TPNTVTYATD EFGGSSSHLG GHNTTGENVQ GGRGRMEVRE RVAFKTKSEI EILDDGFKWR 120 KYGKKMVKNS PNPRNYYRCS VDGCPVKKRV ERDREDPMYV ITTYEGVHNH QSSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-25 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-25 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 3e-35 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 3e-35 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008220527.1 | 1e-64 | PREDICTED: probable WRKY transcription factor 50 isoform X1 | ||||
Swissprot | Q8VWQ5 | 1e-45 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A2P5DEQ1 | 8e-70 | A0A2P5DEQ1_PARAD; WRKY domain containing protein | ||||
STRING | XP_008220527.1 | 4e-64 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 3e-46 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|