PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G009814.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 19081.4 Da PI: 6.8847 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 162.5 | 6e-51 | 1 | 90 | 8 | 97 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+eg++ HL.SW.v1.0.G009814.1 1 MPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRETEGDR 90 8***************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 2.02E-36 | 1 | 95 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.2E-46 | 1 | 95 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-25 | 1 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.9E-17 | 28 | 46 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 31 | 47 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.9E-17 | 47 | 65 | No hit | No description |
PRINTS | PR00615 | 5.9E-17 | 66 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MPIANVIRIM RKILPPHAKI SDDAKETIQE CVSEYISFIT GEANERCQRE QRKTITAEDV 60 LWAMSKLGFD DYIEPLTLYL HRYRETEGDR ATIRGGAGSA SDLVAAPFMK RLGSLDYSAL 120 ATGFVPNAAS FHVAGHHHNG FFGYFKDATA ATASGAGGGS SQAAVANGEQ VHGQYK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 6e-58 | 1 | 85 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC243257 | 2e-70 | AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence. | |||
GenBank | KT726906 | 2e-70 | KT726906.1 Hordeum vulgare cultivar Hua30 nuclear factor Y B subunit (HIPP1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023873931.1 | 2e-74 | nuclear transcription factor Y subunit B-6 isoform X1 | ||||
Refseq | XP_023873932.1 | 2e-74 | nuclear transcription factor Y subunit B-6 isoform X2 | ||||
Swissprot | Q84W66 | 7e-61 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A2P5EXN7 | 3e-92 | A0A2P5EXN7_TREOI; Nuclear transcription factor Y subunit B | ||||
STRING | XP_010087666.1 | 8e-73 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 4e-63 | nuclear factor Y, subunit B6 |