PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G000205.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 101aa MW: 10779 Da PI: 8.0662 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.7 | 5.8e-33 | 23 | 78 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +vrY eC+kNhAas+Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve HL.SW.v1.0.G000205.1 23 SVRYGECQKNHAASVGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREVEA 78 79**************************9.999*********************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 4.0E-17 | 1 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.5E-31 | 24 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 6.4E-28 | 25 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.469 | 26 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MRKRQVVVRR EEISRSMAAA VRSVRYGECQ KNHAASVGGY AVDGCREFMA SGEEGTTAAL 60 TCAACGCHRN FHRREVEASS TNHHEVVCDS CSSPSSSNGV * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022740047.1 | 8e-48 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 1e-38 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A061EEU8 | 2e-43 | A0A061EEU8_THECC; Mini zinc finger 2 isoform 1 | ||||
TrEMBL | A0A061EGD2 | 2e-43 | A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment) | ||||
TrEMBL | B9T6Z4 | 9e-44 | B9T6Z4_RICCO; Transcription factor, putative | ||||
STRING | EOY03457 | 4e-44 | (Theobroma cacao) | ||||
STRING | XP_002534013.1 | 2e-44 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-24 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|