PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Han006235 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 246aa MW: 28606.4 Da PI: 9.6663 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.6 | 9.1e-30 | 35 | 84 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++ rqvtf+kRrng+lKKA+ELSvLCdae+ +i+fss+g+lyey+ Han006235 35 KRIENNTHRQVTFCKRRNGLLKKAYELSVLCDAEITLIVFSSRGRLYEYA 84 79***********************************************8 PP | |||||||
2 | K-box | 98.3 | 1.1e-32 | 108 | 198 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++e +a+ ++qe++kL+++i++Lq+++Rhl+G++Le L++keL+qLe +Lek++++iRsk+++l+l+++e+l k+e el+++n Lr+k++ Han006235 108 TQEVNAQFYKQESKKLRQQIQMLQNTNRHLMGDGLEHLNVKELKQLEGRLEKGISRIRSKRHDLILAETENLEKREIELEHHNAFLRSKVQ 198 678899**********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.9E-40 | 27 | 86 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.403 | 27 | 87 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.36E-32 | 28 | 103 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.63E-42 | 28 | 101 | No hit | No description |
PRINTS | PR00404 | 1.3E-31 | 29 | 49 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 29 | 83 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-25 | 36 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-31 | 49 | 64 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-31 | 64 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.4E-25 | 110 | 197 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.484 | 113 | 203 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
XGIQISFDRL NSFSETGALS SSKEEKMGRG KIEIKRIENN THRQVTFCKR RNGLLKKAYE 60 LSVLCDAEIT LIVFSSRGRL YEYANNNIKS TIERYKKATS STPDTWSTQE VNAQFYKQES 120 KKLRQQIQML QNTNRHLMGD GLEHLNVKEL KQLEGRLEKG ISRIRSKRHD LILAETENLE 180 KREIELEHHN AFLRSKVQVA ESMQQLNMNT GEDYNAWQAY MARNMLHLHI MEPMTLEASP 240 SPFLIV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 27 | 95 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021983447.1 | 1e-159 | agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-102 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A251TXW9 | 1e-158 | A0A251TXW9_HELAN; Putative K-box region and MADS-box transcription factor family protein | ||||
STRING | Solyc11g028020.1.1 | 1e-112 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 7e-98 | MIKC_MADS family protein |