PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han003232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family MYB_related
Protein Properties Length: 213aa    MW: 24532.4 Da    PI: 9.1697
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S48320282PU_unrefUnigeneView CDS
PUT-169a-Helianthus_annuus-21301PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-152569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE+  +++a k++G   W +I +++g ++t+ q++s+ qk+
        Han003232 25 REKWTEEEHNSFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 69
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171975IPR009057Homeodomain-like
PROSITE profilePS5129419.0682074IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-92271IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-172372IPR006447Myb domain, plants
SMARTSM007176.6E-122472IPR001005SANT/Myb domain
PfamPF002491.9E-132568IPR001005SANT/Myb domain
CDDcd001677.68E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MESSSGYGEN QNIKTRKPYT ITKQREKWTE EEHNSFLEAL KLYGRAWQRI EEHIGTKTAV  60
QIRSHAQKFF TKLEKEAVAK GVPVSQALDM EIPPPRPKRK PNYPYPRKTQ TQVPEKDEKQ  120
ATLVSSLQVM DLERKPLPEK TSHREKLENA KTSEEAQNGT TKDPQEVPYA SLSSENENSI  180
PRSNPDVFRR DVTNASYITI EARKHQELDQ DGN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Han.98600.0embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, roots, stems, flowers and siliques. {ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the circadian clock. Binds to the promoter region of APRR1/TOC1 and TCP21/CHE to repress their transcription. Represses both CCA1 and itself. {ECO:0000269|PubMed:12015970, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:9657154}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with peak levels occurring around 1 hour after dawn. Up-regulated by APRR1/TOC1 and transiently by light treatment. Down-regulated by APRR5, APRR7 and APRR9. {ECO:0000269|PubMed:12574129, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:19286557, ECO:0000269|PubMed:20233950, ECO:0000269|PubMed:9657154}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021983242.11e-151protein LHY-like isoform X1
RefseqXP_021983243.11e-151protein LHY-like isoform X1
RefseqXP_021983244.11e-151protein LHY-like isoform X1
RefseqXP_021983245.11e-151protein LHY-like isoform X1
RefseqXP_021983246.11e-151protein LHY-like isoform X1
RefseqXP_021983247.11e-151protein LHY-like isoform X1
RefseqXP_021983248.11e-151protein LHY-like isoform X1
RefseqXP_021983249.11e-152protein LHY-like isoform X2
SwissprotQ6R0H16e-50LHY_ARATH; Protein LHY
TrEMBLA0A251TYD11e-149A0A251TYD1_HELAN; Putative circadian clock associated 1
STRINGXP_002515093.11e-63(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.42e-46MYB_related family protein
Publications ? help Back to Top
  1. Pokhilko A,Mas P,Millar AJ
    Modelling the widespread effects of TOC1 signalling on the plant circadian clock and its outputs.
    BMC Syst Biol, 2013. 7: p. 23
    [PMID:23506153]
  2. Kim Y, et al.
    Balanced nucleocytosolic partitioning defines a spatial network to coordinate circadian physiology in plants.
    Dev. Cell, 2013. 26(1): p. 73-85
    [PMID:23830866]
  3. Karayekov E,Sellaro R,Legris M,Yanovsky MJ,Casal JJ
    Heat shock-induced fluctuations in clock and light signaling enhance phytochrome B-mediated Arabidopsis deetiolation.
    Plant Cell, 2013. 25(8): p. 2892-906
    [PMID:23933882]
  4. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Qian H, et al.
    The circadian clock gene regulatory module enantioselectively mediates imazethapyr-induced early flowering in Arabidopsis thaliana.
    J. Plant Physiol., 2014. 171(5): p. 92-8
    [PMID:24484962]
  7. McClung CR
    Wheels within wheels: new transcriptional feedback loops in the Arabidopsis circadian clock.
    F1000Prime Rep, 2014. 6: p. 2
    [PMID:24592314]
  8. Gulledge AA,Vora H,Patel K,Loraine AE
    A protocol for visual analysis of alternative splicing in RNA-Seq data using integrated genome browser.
    Methods Mol. Biol., 2014. 1158: p. 123-37
    [PMID:24792048]
  9. Hsiao AS, et al.
    Gene expression in plant lipid metabolism in Arabidopsis seedlings.
    PLoS ONE, 2014. 9(9): p. e107372
    [PMID:25264899]
  10. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  11. Litthauer S,Battle MW,Lawson T,Jones MA
    Phototropins maintain robust circadian oscillation of PSII operating efficiency under blue light.
    Plant J., 2015. 83(6): p. 1034-45
    [PMID:26215041]
  12. Flis A, et al.
    Defining the robust behaviour of the plant clock gene circuit with absolute RNA timeseries and open infrastructure.
    Open Biol, 2016.
    [PMID:26468131]
  13. Adams S,Manfield I,Stockley P,Carré IA
    Revised Morning Loops of the Arabidopsis Circadian Clock Based on Analyses of Direct Regulatory Interactions.
    PLoS ONE, 2015. 10(12): p. e0143943
    [PMID:26625126]
  14. Kamioka M, et al.
    Direct Repression of Evening Genes by CIRCADIAN CLOCK-ASSOCIATED1 in the Arabidopsis Circadian Clock.
    Plant Cell, 2016. 28(3): p. 696-711
    [PMID:26941090]
  15. Baduel P,Arnold B,Weisman CM,Hunter B,Bomblies K
    Habitat-Associated Life History and Stress-Tolerance Variation in Arabidopsis arenosa.
    Plant Physiol., 2016. 171(1): p. 437-51
    [PMID:26941193]
  16. Park MJ,Kwon YJ,Gil KE,Park CM
    LATE ELONGATED HYPOCOTYL regulates photoperiodic flowering via the circadian clock in Arabidopsis.
    BMC Plant Biol., 2016. 16(1): p. 114
    [PMID:27207270]
  17. Nitschke S, et al.
    Circadian Stress Regimes Affect the Circadian Clock and Cause Jasmonic Acid-Dependent Cell Death in Cytokinin-Deficient Arabidopsis Plants.
    Plant Cell, 2016. 28(7): p. 1616-39
    [PMID:27354555]
  18. Higashi T,Aoki K,Nagano AJ,Honjo MN,Fukuda H
    Circadian Oscillation of the Lettuce Transcriptome under Constant Light and Light-Dark Conditions.
    Front Plant Sci, 2016. 7: p. 1114
    [PMID:27512400]
  19. Marshall CM,Tartaglio V,Duarte M,Harmon FG
    The Arabidopsis sickle Mutant Exhibits Altered Circadian Clock Responses to Cool Temperatures and Temperature-Dependent Alternative Splicing.
    Plant Cell, 2016. 28(10): p. 2560-2575
    [PMID:27624757]
  20. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  21. Wendell M, et al.
    Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern.
    Plant Cell Physiol., 2017. 58(3): p. 466-477
    [PMID:28028164]
  22. Woloszynska M, et al.
    The Elongator complex regulates hypocotyl growth in darkness and during photomorphogenesis.
    J. Cell. Sci., 2019.
    [PMID:28720596]
  23. Li Z,Bonaldi K,Uribe F,Pruneda-Paz JL
    A Localized Pseudomonas syringae Infection Triggers Systemic Clock Responses in Arabidopsis.
    Curr. Biol., 2018. 28(4): p. 630-639.e4
    [PMID:29398214]
  24. James AB,Sullivan S,Nimmo HG
    Global spatial analysis of Arabidopsis natural variants implicates 5'UTR splicing of LATE ELONGATED HYPOCOTYL in responses to temperature.
    Plant Cell Environ., 2018. 41(7): p. 1524-1538
    [PMID:29520807]
  25. James AB, et al.
    How does temperature affect splicing events? Isoform switching of splicing factors regulates splicing of LATE ELONGATED HYPOCOTYL (LHY).
    Plant Cell Environ., 2018. 41(7): p. 1539-1550
    [PMID:29532482]