PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN47096.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 7098.24 Da PI: 10.4603

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN47096.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.8	5.9e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fss+g+lyeys+ KHN47096.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.88	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.6E-42	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.31E-30	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.29E-38	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.2E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVSLIVFSS RGRLYEYSNN 60 K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	2e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269\|PubMed:11828031, ECO:0000269\|PubMed:16326928, ECO:0000269\|PubMed:9869408}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN47096.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT091029	1e-87	BT091029.1 Soybean clone JCVI-FLGm-14D24 unknown mRNA.
GenBank	DQ371899	1e-87	DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011016424.1	1e-36	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Swissprot	Q40704	1e-36	MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBL	A0A151RFR1	1e-35	A0A151RFR1_CAJCA; MADS-box transcription factor 3
TrEMBL	A0A426XLP8	2e-35	A0A426XLP8_ENSVE; Uncharacterized protein
STRING	POPTR_0013s09960.1	3e-36	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	4e-38	MIKC_MADS family protein

Publications ? help Back to Top
Kyozuka J,Shimamoto K Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants. Plant Cell Physiol., 2002. 43(1): p. 130-5 [PMID:11828031] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933]