PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN43150.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 73aa MW: 7887.2 Da PI: 9.8551 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 60.9 | 2.7e-19 | 13 | 65 | 83 | 137 |
Whirly 83 kgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137 +sn+G+vrk+l+++P+++ G+fv+l+v n+l+++n++fsvPv+ aefav++++ KHN43150.1 13 TSSNAGQVRKSLSIKPHAN--GYFVSLTVVNNLLNTNDYFSVPVTTAEFAVMKTA 65 689**************97..69******************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54447 | 3.45E-16 | 7 | 70 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 1.6E-16 | 12 | 69 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 6.1E-16 | 13 | 65 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MFKLSRMLPL TSTSSNAGQV RKSLSIKPHA NGYFVSLTVV NNLLNTNDYF SVPVTTAEFA 60 VMKTACSVCL LSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4kop_A | 1e-23 | 14 | 70 | 99 | 157 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_B | 1e-23 | 14 | 70 | 99 | 157 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_C | 1e-23 | 14 | 70 | 99 | 157 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_D | 1e-23 | 14 | 70 | 99 | 157 | Single-stranded DNA-binding protein WHY2, mitochondrial |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN43150.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT094885 | 6e-81 | BT094885.1 Soybean clone JCVI-FLGm-6I20 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003554728.1 | 2e-31 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
Refseq | XP_028216373.1 | 2e-31 | single-stranded DNA-binding protein WHY2, mitochondrial-like | ||||
Swissprot | Q8VYF7 | 9e-23 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A445FLA4 | 3e-31 | A0A445FLA4_GLYSO; Single-stranded DNA-binding protein WHY2, mitochondrial isoform B | ||||
STRING | GLYMA19G43880.2 | 1e-30 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11383 | 33 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 8e-19 | WHIRLY 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|