PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN43088.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 107aa MW: 12519.5 Da PI: 10.0429 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 116 | 4.7e-36 | 1 | 106 | 267 | 373 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365 +++s++ +lpr+s++r++vE+++l+r+ivn++aceg+er+erhe l+kW++rl+ aGF+++pl+++++ +k+llr ++ + y++ e++g+++ gWkdr KHN43088.1 1 MLESIDLSLPRKSKQRVNVEQHCLARNIVNIIACEGKERVERHELLGKWKSRLTIAGFRQYPLGSYVNFVIKSLLRWYP-EHYNLVEKDGAMLVGWKDR 98 79*****************************************************************************.55***************** PP GRAS 366 pLvsvSaW 373 +L+s+SaW KHN43088.1 99 NLISASAW 106 ******** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 1.6E-33 | 1 | 106 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 17.788 | 1 | 88 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MLESIDLSLP RKSKQRVNVE QHCLARNIVN IIACEGKERV ERHELLGKWK SRLTIAGFRQ 60 YPLGSYVNFV IKSLLRWYPE HYNLVEKDGA MLVGWKDRNL ISASAWH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN43088.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003526176.1 | 2e-62 | scarecrow-like protein 21 | ||||
Refseq | XP_006582237.1 | 2e-62 | scarecrow-like protein 21 | ||||
Refseq | XP_006582238.1 | 2e-62 | scarecrow-like protein 21 | ||||
Swissprot | Q69VG1 | 4e-52 | CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1 | ||||
TrEMBL | A0A0B2SE62 | 2e-73 | A0A0B2SE62_GLYSO; Chitin-inducible gibberellin-responsive protein 1 | ||||
STRING | GLYMA06G41500.1 | 7e-62 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF36930 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48150.2 | 6e-47 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|