PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN35329.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 141aa MW: 15832.9 Da PI: 6.5085 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 142.8 | 1.4e-44 | 1 | 101 | 35 | 137 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefav 133 ++ ++ +++erkydW+k+q+falsatev++l+ + +++sc+ffhdp++ +sn+G+vrk+l+++P+++ G+fv+l+v n+l++++++fsvPv+ aefav KHN35329.1 1 MMSFMHSIGERKYDWDKRQKFALSATEVGSLITMDAQDSCDFFHDPSMLSSNAGQVRKSLSIKPHAN--GYFVSLTVVNNLLNTKDYFSVPVTTAEFAV 97 899**************************************************************97..69**************************** PP Whirly 134 lrsl 137 ++++ KHN35329.1 98 MKTA 101 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF08536 | 1.2E-41 | 1 | 100 | IPR013742 | Plant transcription factor |
SuperFamily | SSF54447 | 1.8E-43 | 1 | 120 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 1.7E-50 | 1 | 120 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MMSFMHSIGE RKYDWDKRQK FALSATEVGS LITMDAQDSC DFFHDPSMLS SNAGQVRKSL 60 SIKPHANGYF VSLTVVNNLL NTKDYFSVPV TTAEFAVMKT ACTFALPHIM GWDQITNQQS 120 RGIDGLQAKG DSKVSELEWE R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 2e-62 | 1 | 118 | 50 | 169 | StWhy2 |
3n1i_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
3n1j_A | 2e-62 | 1 | 118 | 50 | 169 | Protein StWhy2 |
3n1k_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
3n1l_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
3r9y_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
3r9z_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
3ra0_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN35329.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT092146 | 0.0 | BT092146.1 Soybean clone JCVI-FLGm-10O7 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001341889.1 | 1e-103 | single-stranded DNA-bindig protein WHY2-like protein | ||||
Refseq | XP_028226778.1 | 1e-103 | single-stranded DNA-binding protein WHY2, mitochondrial-like | ||||
Swissprot | D9J034 | 4e-65 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A0B2RSX1 | 1e-103 | A0A0B2RSX1_GLYSO; Uncharacterized protein | ||||
TrEMBL | I1JRU0 | 1e-102 | I1JRU0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G41270.1 | 1e-103 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11383 | 33 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 3e-64 | WHIRLY 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|