PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN30840.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 89aa MW: 9582.8 Da PI: 8.855 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 102 | 4.2e-32 | 20 | 77 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++rY eC+kNhAa++Gg+avDGC+Efm+s + eg al+CaACgCHRnFHRrev++e KHN30840.1 20 RNIRYGECQKNHAANIGGYAVDGCREFMAS-TGEGAGGALTCAACGCHRNFHRREVNTE 77 579**************************9.667899******************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 3.0E-22 | 1 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 7.9E-29 | 22 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 5.8E-26 | 23 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.257 | 24 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MKKRQVVVKS VANTSSSVMR NIRYGECQKN HAANIGGYAV DGCREFMAST GEGAGGALTC 60 AACGCHRNFH RREVNTEVVC EYSPPNSGR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN30840.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 2e-90 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003522326.1 | 3e-60 | mini zinc finger protein 3 | ||||
Refseq | XP_014632621.1 | 3e-60 | mini zinc finger protein 3 | ||||
Refseq | XP_028229098.1 | 3e-60 | mini zinc finger protein 3-like | ||||
Refseq | XP_028237252.1 | 3e-60 | mini zinc finger protein 3-like | ||||
Swissprot | Q2Q493 | 7e-40 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A0B2RJL3 | 6e-59 | A0A0B2RJL3_GLYSO; Mini zinc finger protein 3 | ||||
TrEMBL | I1JWV2 | 6e-59 | I1JWV2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA04G33640.1 | 1e-59 | (Glycine max) | ||||
STRING | GLYMA06G20810.1 | 1e-59 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 1e-33 | mini zinc finger |
Publications ? help Back to Top | |||
---|---|---|---|
|