PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN26570.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NF-YB

Protein Properties

Length: 143aa MW: 16584.5 Da PI: 4.9354

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN26570.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	173.9	1.7e-54	17	112	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+r+mk++lP+nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd++walatlGf+dy+ep++ yl++yre+e ++ KHN26570.1 17 KEQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALATLGFDDYAEPMRRYLHRYREVEVDH 112 89******************************************************************************************9885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-52	11	134	IPR009072	Histone-fold
SuperFamily	SSF47113	2.79E-39	19	127	IPR009072	Histone-fold
Pfam	PF00808	2.2E-27	22	86	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	9.4E-19	50	68	No hit	No description
PROSITE pattern	PS00685	0	53	69	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	9.4E-19	69	87	No hit	No description
PRINTS	PR00615	9.4E-19	88	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MEDSIGGSSS NDNNIIKEQD RLLPIANVGR LMKQILPQNA KISKEAKETM QECVSEFISF 60 VTSEASEKCR KERRKTVNGD DICWALATLG FDDYAEPMRR YLHRYREVEV DHNNKVNLQE 120 RENNSPEEKD DEVFQLSNRG VRF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	6e-45	16	107	1	92	Transcription factor HapC (Eurofung)
4g92_B	6e-45	16	107	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN26570.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014617240.1	1e-103	nuclear transcription factor Y subunit B-5 isoform X1
Refseq	XP_028180553.1	1e-103	nuclear transcription factor Y subunit B-5-like isoform X1
Swissprot	O82248	6e-55	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A0B2QKX1	4e-80	A0A0B2QKX1_GLYSO; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A0R0G186	4e-80	A0A0R0G186_SOYBN; Uncharacterized protein
STRING	XP_004508609.1	2e-73	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-56	nuclear factor Y, subunit B5

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]