PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN17282.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 74aa MW: 8870.94 Da PI: 4.7537 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 56.1 | 6.1e-18 | 20 | 71 | 2 | 53 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 +kR t+ ql++Le++++++ yp++e++ LA++lgLte+q++ WF+ rR KHN17282.1 20 KKRKLKTPAQLKALEDFYNEHEYPTEEMKLVLAEELGLTEKQISGWFCHRRL 71 89*************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.7E-20 | 5 | 70 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.84E-17 | 14 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 15.435 | 16 | 74 | IPR001356 | Homeobox domain |
SMART | SM00389 | 9.3E-10 | 18 | 74 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.7E-15 | 20 | 71 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.76E-13 | 20 | 70 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MEESSELQSE ENKVSNEKNK KRKLKTPAQL KALEDFYNEH EYPTEEMKLV LAEELGLTEK 60 QISGWFCHRR LEDW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN17282.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003519513.1 | 3e-35 | uncharacterized protein LOC100805913 isoform X1 | ||||
Refseq | XP_006575626.1 | 2e-35 | uncharacterized protein LOC100805913 isoform X2 | ||||
Refseq | XP_028219628.1 | 2e-35 | uncharacterized protein LOC114401325 isoform X1 | ||||
Refseq | XP_028219637.1 | 3e-35 | uncharacterized protein LOC114401325 isoform X2 | ||||
Swissprot | F4HY56 | 1e-12 | RLT1_ARATH; Homeobox-DDT domain protein RLT1 | ||||
TrEMBL | A0A0B2QBX2 | 3e-46 | A0A0B2QBX2_GLYSO; Uncharacterized protein | ||||
STRING | GLYMA02G44910.1 | 1e-34 | (Glycine max) | ||||
STRING | GLYMA04G15260.1 | 1e-36 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5792 | 30 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G03250.1 | 4e-22 | HB-other family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|