PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN15689.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 200aa MW: 23204.3 Da PI: 9.5442 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.1 | 1.2e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+++ rqv fskRr g+lKKA+ELSvLCdaevavi+fs++g+lye+ss KHN15689.1 9 KKIEDTTSRQVAFSKRRSGLLKKAYELSVLCDAEVAVIVFSQNGRLYEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 62 | 2.3e-21 | 84 | 164 | 12 | 92 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++l+ ++ + k+ie L++++R+llG++++s+s+ eL+ +e+qL +sl+++R++K++l++eqi++l+ + +++++ + KHN15689.1 84 DYIQQLKLDSVSMTKKIELLEHSKRKLLGQSVSSCSFDELKGIEEQLRTSLQRVRQRKTQLYTEQIDRLRSQYQRAERSSQ 164 556888999999**********************************************************99998887655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.174 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.8E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.22E-31 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.65E-39 | 3 | 75 | No hit | No description |
PRINTS | PR00404 | 3.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.216 | 86 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-18 | 87 | 161 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MVRGKVQLKK IEDTTSRQVA FSKRRSGLLK KAYELSVLCD AEVAVIVFSQ NGRLYEFSSS 60 DMTKILERYR EYTKDVPGSK FGDDYIQQLK LDSVSMTKKI ELLEHSKRKL LGQSVSSCSF 120 DELKGIEEQL RTSLQRVRQR KTQLYTEQID RLRSQYQRAE RSSQQQWPRH TQAEAEPHCS 180 SSQSLDVDTE LFIGLPKQQC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 7e-23 | 1 | 90 | 1 | 89 | MEF2 CHIMERA |
6byy_B | 7e-23 | 1 | 90 | 1 | 89 | MEF2 CHIMERA |
6byy_C | 7e-23 | 1 | 90 | 1 | 89 | MEF2 CHIMERA |
6byy_D | 7e-23 | 1 | 90 | 1 | 89 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN15689.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028220997.1 | 1e-144 | MADS-box protein AGL42-like isoform X2 | ||||
Swissprot | Q9FIS1 | 3e-67 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A445F5J1 | 1e-143 | A0A445F5J1_GLYSO; MADS-box protein AGL42 isoform B | ||||
STRING | GLYMA20G29300.1 | 1e-139 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-69 | AGAMOUS-like 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|