PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN00692.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 168aa MW: 18168.5 Da PI: 10.1188 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.7 | 6.9e-18 | 74 | 107 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C +C tkTp+WR gp g+ktLCnaCG++y++ + KHN00692.1 74 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 107 99*****************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.543 | 68 | 104 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 9.1E-17 | 68 | 118 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 4.9E-15 | 72 | 105 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 2.8E-15 | 72 | 131 | No hit | No description |
CDD | cd00202 | 4.83E-13 | 73 | 120 | No hit | No description |
Pfam | PF00320 | 1.5E-15 | 74 | 108 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 74 | 99 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MQLISPASST GENVQHNATT TSKAASSDSE NFAESVIKGP KQASGEHKNK RKIKVTFSSG 60 QEQQNAPSQA VRKCLHCEIT KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF 120 CAAVHSNSHK KVIEMRNKTG TKSGFATDSP ASPELIPNTN NSLTLEYM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN00692.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006574762.1 | 1e-120 | GATA transcription factor 8 isoform X2 | ||||
Refseq | XP_006574763.1 | 1e-120 | GATA transcription factor 8 isoform X2 | ||||
Refseq | XP_028199239.1 | 1e-120 | GATA transcription factor 8-like isoform X2 | ||||
Refseq | XP_028199247.1 | 1e-120 | GATA transcription factor 8-like isoform X2 | ||||
Swissprot | Q9SV30 | 2e-42 | GATA8_ARATH; GATA transcription factor 8 | ||||
TrEMBL | A0A445LKP3 | 1e-118 | A0A445LKP3_GLYSO; GATA transcription factor | ||||
TrEMBL | K7K6X9 | 1e-118 | K7K6X9_SOYBN; GATA transcription factor | ||||
TrEMBL | K7K6Y1 | 1e-119 | K7K6Y1_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA02G08145.2 | 1e-119 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4887 | 33 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 2e-44 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|