PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHM99082.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 168aa MW: 19007.3 Da PI: 5.9301 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 166.4 | 3.6e-52 | 4 | 99 | 1 | 96 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 vreqd+++Pianv+rim+++lPa+akis+daket+qecvse+isf+t+ea+++cqre+rkt++++d+lwa+ +lGf++y++pl++yl++yre ege KHM99082.1 4 VREQDQYMPIANVIRIMRRILPAHAKISDDAKETIQECVSEYISFITAEANERCQREQRKTVTAEDVLWAMEKLGFDNYAHPLSLYLHRYRESEGE 99 69*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-48 | 3 | 110 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.16E-37 | 7 | 115 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-25 | 10 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.7E-16 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 7.7E-16 | 57 | 75 | No hit | No description |
PRINTS | PR00615 | 7.7E-16 | 76 | 94 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MAGVREQDQY MPIANVIRIM RRILPAHAKI SDDAKETIQE CVSEYISFIT AEANERCQRE 60 QRKTVTAEDV LWAMEKLGFD NYAHPLSLYL HRYRESEGEP ASVRRASSAM GINNNMVHPP 120 YINSHGFGMF DFDPSSQGFY RDDHNAASGS GGFVAPFDPY ANIKRDAL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 4e-58 | 4 | 95 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHM99082.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY058918 | 1e-149 | AY058918.1 Glycine max clone ses2w.pk0015.a4 CCAAT-box binding factor HAP3 B domain mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003556590.1 | 1e-125 | nuclear transcription factor Y subunit B-6 | ||||
Refseq | XP_025983113.1 | 1e-125 | nuclear transcription factor Y subunit B-6 | ||||
Refseq | XP_028219498.1 | 1e-125 | nuclear transcription factor Y subunit B-6-like | ||||
Refseq | XP_028219500.1 | 1e-125 | nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 6e-59 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A0B2NV02 | 1e-124 | A0A0B2NV02_GLYSO; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | I1NCV5 | 1e-124 | I1NCV5_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA20G00240.1 | 1e-124 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 1e-61 | nuclear factor Y, subunit B6 |