PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.N017200.3

Common Name

B456_N017200, LOC105784902

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MIKC_MADS

Protein Properties

Length: 247aa MW: 28296 Da PI: 9.8716

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.N017200.3	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.3	1.5e-31	24	73	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Gorai.N017200.3 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 73 79***********************************************8 PP
2	K-box	114.7	8.8e-38	91	187	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 s++ s++e +a+ +qqe++kL+++i+nLq+ +Rh+lGe+++ L +keL++Le++Lek++++iRskKnell+++ie++qk+e +l+++n+ Lr+k Gorai.N017200.3 91 SNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAK 184 3344499*************************************************************************************** PP K-box 98 lee 100 ++e Gorai.N017200.3 185 IAE 187 986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-42	16	75	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.132	16	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.39E-46	17	91	No hit	No description
SuperFamily	SSF55455	3.92E-34	17	105	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-33	18	38	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	18	72	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.2E-27	25	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-33	38	53	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-33	53	74	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	9.5E-28	100	185	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.999	101	191	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048366	Biological Process	leaf development
GO:0048440	Biological Process	carpel development
GO:0048443	Biological Process	stamen development
GO:0048497	Biological Process	maintenance of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 247 aa Download sequence Send to blast
MVYPNESLEN SPQKKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSSRGRLY EYANNSVKAT IERYKKASDS SNTGSVAEVN AQFYQQEADK LRNQIRNLQN 120 ANRHMLGESI GGLPMKELKS LESRLEKGIS RIRSKKNELL FAEIEYMQKR EIDLHNNNQL 180 LRAKIAENER KQQSMNLMPG GSSANFEALH SQPYDSRNYF QVDALQPATN YYNPQQQQDQ 240 IALQLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_A	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	16	89	1	74	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gra.1551	0.0	flower\| flowering

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected early in the floral meristem but mostly expressed in stamen and carpel primordia. {ECO:0000269\|PubMed:1675158}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00609	ChIP-seq	Transfer from AT4G18960	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU881510	0.0	EU881510.1 Gossypium hirsutum MADS10 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012466276.1	0.0	PREDICTED: floral homeotic protein AGAMOUS-like isoform X3
Refseq	XP_012466277.1	0.0	PREDICTED: floral homeotic protein AGAMOUS-like isoform X3
Swissprot	P17839	1e-126	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	A0A0D2WAI1	1e-180	A0A0D2WAI1_GOSRA; Uncharacterized protein
STRING	Gorai.N017200.1	0.0	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-125	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Gorai.N017200.3
Entrez Gene	105784902

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]