PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G251200.4 | ||||||||
Common Name | B456_013G251200, LOC105783148 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 174aa MW: 18968.3 Da PI: 10.6928 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.9 | 7.2e-33 | 31 | 87 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQyq+Il+RRq+Rak+e ekk+ ksrkpylheSRh+hAlrR+RgsgGrF Gorai.013G251200.4 31 QEPVYVNAKQYQGILRRRQARAKAELEKKV-VKSRKPYLHESRHQHALRRARGSGGRF 87 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.8E-35 | 29 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.949 | 30 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.4E-29 | 32 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.2E-24 | 33 | 55 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 35 | 55 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.2E-24 | 64 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0055046 | Biological Process | microgametogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MMAAYGHQPM GYPPFVGMPH ARMTLPIEMA QEPVYVNAKQ YQGILRRRQA RAKAELEKKV 60 VKSRKPYLHE SRHQHALRRA RGSGGRFAKK TDTNPGEEKG SGSGPTLSSQ SPSSSGSEPL 120 QTDSNETWTS SLTQHAIHHV NGGSHYQKLG GNISNQAAFY PVNGGQSFQK LKG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 7e-20 | 31 | 87 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 2e-36 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012463850.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X1 | ||||
Refseq | XP_012463851.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X2 | ||||
Refseq | XP_012463853.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X2 | ||||
Refseq | XP_012463854.1 | 1e-126 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3 | ||||
Refseq | XP_012463855.1 | 1e-126 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3 | ||||
Refseq | XP_012463856.1 | 1e-126 | PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3 | ||||
Swissprot | Q9LXV5 | 2e-53 | NFYA1_ARATH; Nuclear transcription factor Y subunit A-1 | ||||
TrEMBL | A0A0D2SI75 | 1e-124 | A0A0D2SI75_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A0D2U590 | 1e-123 | A0A0D2U590_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A0D2VIR2 | 1e-125 | A0A0D2VIR2_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G251200.1 | 1e-124 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 2e-51 | nuclear factor Y, subunit A9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G251200.4 |
Entrez Gene | 105783148 |
Publications ? help Back to Top | |||
---|---|---|---|
|