PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G225300.1 | ||||||||
Common Name | B456_013G225300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 182aa MW: 20987.1 Da PI: 9.8713 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 75.2 | 6.8e-24 | 74 | 118 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+ ++ ++k+CErH+hrg++rsrk++ee Gorai.013G225300.1 74 DPEPGRCRRTDGKKWRCSKLAYTDSKYCERHMHRGKNRSRKHVEE 118 79*****************************************97 PP | |||||||
2 | QLQ | 45.9 | 1.7e-16 | 13 | 46 | 2 | 35 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 +FTa+Q+++L +Q+l++Ky++ + P+P++Ll+ i Gorai.013G225300.1 13 PFTATQWEELQNQVLIFKYMVLGIPIPSYLLFTI 46 8*****************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 6.0E-8 | 12 | 48 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 1.7E-11 | 13 | 46 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 17.788 | 13 | 48 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 23.507 | 74 | 118 | IPR014977 | WRC domain |
Pfam | PF08879 | 1.1E-19 | 75 | 117 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MMMMSGRNSS RFPFTATQWE ELQNQVLIFK YMVLGIPIPS YLLFTIKTSF LEPHQHDKIG 60 WNCGGEMRMV RKVDPEPGRC RRTDGKKWRC SKLAYTDSKY CERHMHRGKN RSRKHVEEEE 120 EASTGITMVN PSSTATQSLS LSFSSFETHA STEKPTLCLL GSSSYRFGHK QPWTQFKLMS 180 F* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}. | |||||
Uniprot | TISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15960617}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:15960617}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX616704 | 0.0 | JX616704.1 Gossypium hirsutum clone NBRI_GE61556 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012465703.1 | 1e-122 | PREDICTED: growth-regulating factor 6-like | ||||
Refseq | XP_012465704.1 | 1e-122 | PREDICTED: growth-regulating factor 6-like | ||||
Refseq | XP_012465705.1 | 1e-122 | PREDICTED: growth-regulating factor 6-like | ||||
Swissprot | Q8L8A6 | 3e-44 | GRF5_ARATH; Growth-regulating factor 5 | ||||
TrEMBL | A0A0D2VHD8 | 1e-134 | A0A0D2VHD8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G225300.1 | 1e-135 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4567 | 26 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 1e-46 | growth-regulating factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G225300.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|