PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G169800.1 | ||||||||
Common Name | B456_013G169800, LOC105782855 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 183aa MW: 20318.7 Da PI: 9.3478 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 139 | 1.3e-43 | 54 | 131 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C dls+ak+yhrrhkvCe+h+kap v+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a Gorai.013G169800.1 54 ACQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSSA 131 5**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.7E-36 | 47 | 116 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 33.094 | 52 | 129 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.59E-41 | 53 | 132 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.5E-33 | 55 | 128 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MNKDFIAEGL DNDMQEEEEE GVGGDHGFPD DEKKKKGYGR RGAAGGGGGV SPPACQVEKC 60 GLDLSDAKRY HRRHKVCEIH AKAPFVVVAG LRQRFCQQCS RFHELPEFDE AKRSCRRRLA 120 GHNERRRKSS AESSSAAESS SRRGMMISAQ LKESHYLADD QRARVNPMAI HGSSSFKRSQ 180 IR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-37 | 45 | 128 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ569110 | 0.0 | KJ569110.1 Gossypium hirsutum squamosa promoter binding protein 3 (SBP3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012463358.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9S7A9 | 6e-46 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A0D2SFJ7 | 1e-130 | A0A0D2SFJ7_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G169800.1 | 1e-131 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 3e-38 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G169800.1 |
Entrez Gene | 105782855 |