PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G153100.1 | ||||||||
Common Name | B456_013G153100, LOC105784004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 173aa MW: 18570.9 Da PI: 6.519 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.4 | 4.4e-58 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +eqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re Gorai.013G153100.1 24 KEQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFRE 114 79***************************************************************************************** PP NF-YB 93 legek 97 +egek Gorai.013G153100.1 115 MEGEK 119 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-54 | 19 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.5E-41 | 26 | 127 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.4E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.5E-21 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.5E-21 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 7.5E-21 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MVDSDTESGG GPNNASNADL SSPKEQDRFL PIANVSRIMK KALPANAKIS KEAKETVQEC 60 VSEFISFITG EASDKCQKEK RKTINGDDLL WAMTTLGFED YVEPLKVYLQ RFREMEGEKT 120 AVARDKDAPL AGGVGAAAAA GSSGMYGMMV HQQHQGHVYG SGGFHQMGRG PR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 24 | 114 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 24 | 114 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gra.332 | 0.0 | flower|seedling| flowering |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ527649 | 1e-104 | HQ527649.1 Gossypium herbaceum clone NBRI_E_3586 simple sequence repeat marker, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012465202.1 | 1e-127 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q75IZ7 | 4e-70 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0D2SEQ7 | 1e-126 | A0A0D2SEQ7_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G153100.1 | 1e-127 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-70 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G153100.1 |
Entrez Gene | 105784004 |
Publications ? help Back to Top | |||
---|---|---|---|
|