PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G069000.2 | ||||||||
Common Name | B456_013G069000, LOC105784095 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 235aa MW: 27738.5 Da PI: 7.5924 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.8 | 5.2e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr+g+lKK +ELSvLCda++ +iifsstgk+ y++ Gorai.013G069000.2 9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKMCQYCT 59 79**********************************************986 PP | |||||||
2 | K-box | 79.1 | 1.1e-26 | 71 | 170 | 1 | 99 |
K-box 1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 yqk +g++ e+ + e+l++ela L+ke++ Lq + R++ Ged++s+ ++eL qLeq+Le+s++k+R++Knell +q+++l++ke++l+ee Gorai.013G069000.2 71 YQKVTGTRiPEHDNREHLYNELAVLRKETRLLQLSMRRYTGEDMSSIPYEELDQLEQELERSVNKVRERKNELLQQQLDNLRRKERMLEEE 161 678888888888999**************************************************************************** PP K-box 91 nkaLrkkle 99 n+++ + ++ Gorai.013G069000.2 162 NNNMYRWIQ 170 **9988766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.801 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.08E-41 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 6.15E-31 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.0E-24 | 81 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.986 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MGRGKIAIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS TGKMCQYCTQ 60 PYRMEQIIER YQKVTGTRIP EHDNREHLYN ELAVLRKETR LLQLSMRRYT GEDMSSIPYE 120 ELDQLEQELE RSVNKVRERK NELLQQQLDN LRRKERMLEE ENNNMYRWIQ EHRAAIEYQQ 180 QGGLEAKPVE HHQQVLDEFP FYGEPSSVLQ LATIPQQFSY QLQLAQPNLQ DSNV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_B | 1e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_C | 1e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_D | 1e-18 | 1 | 71 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM236444 | 0.0 | HM236444.1 Gossypium hirsutum MADS28 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012465338.1 | 1e-173 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X1 | ||||
Refseq | XP_012465339.1 | 1e-173 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X1 | ||||
Refseq | XP_012465340.1 | 1e-173 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X1 | ||||
Swissprot | Q8RYD9 | 4e-93 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A0D2VBN4 | 1e-172 | A0A0D2VBN4_GOSRA; Uncharacterized protein | ||||
STRING | EOX99096 | 1e-159 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6506 | 25 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 4e-89 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G069000.2 |
Entrez Gene | 105784095 |