PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G054000.3 | ||||||||
Common Name | B456_013G054000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 26240.8 Da PI: 9.4773 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 76.2 | 2.5e-24 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie +s rqvtfskRrng+lKKA+EL +LCdae +iifsst kl+ ++s Gorai.013G054000.3 9 KKIEKSSSRQVTFSKRRNGLLKKAKELAILCDAELGLIIFSSTSKLHHFAS 59 68**********************************************986 PP | |||||||
2 | K-box | 79.4 | 8.7e-27 | 84 | 172 | 11 | 99 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +++ + +++e+a L+++++ Lq+ +R+l+Ge+L+ Ls+k+L++Le+qLe slk++R +K ++++++ elqkk + + +en++L++k++ Gorai.013G054000.3 84 ASELKFWEKEVASLRQQLNDLQEYHRQLMGEELSGLSIKDLRNLENQLEMSLKSVRMRKGHHIHKENLELQKKLDLICQENTELQRKVD 172 57789*********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.782 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.79E-42 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 3.14E-31 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.4E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.0E-23 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.239 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MGRGKIEIKK IEKSSSRQVT FSKRRNGLLK KAKELAILCD AELGLIIFSS TSKLHHFASS 60 SMKSVIERYN KYREEYHRQL LDPASELKFW EKEVASLRQQ LNDLQEYHRQ LMGEELSGLS 120 IKDLRNLENQ LEMSLKSVRM RKGHHIHKEN LELQKKLDLI CQENTELQRK VDGNGTVEAN 180 EGSKSSSHSY GFNNGYDELQ APVVDLRLSQ PQQLPDADTS YRNLRLL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 1e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 1e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 1e-21 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:17704216}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012463559.1 | 1e-165 | PREDICTED: MADS-box transcription factor 23-like isoform X3 | ||||
Swissprot | A2RVQ5 | 5e-75 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A0D2V9P3 | 1e-164 | A0A0D2V9P3_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G054000.1 | 1e-162 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 8e-71 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G054000.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|