PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.012G134200.3 | ||||||||
Common Name | B456_012G134200, LOC105780198 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 27502.3 Da PI: 7.5439 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84 | 8.9e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr+g+lKK +ELSvLCda++ +iifs+tgk+ y++ Gorai.012G134200.3 9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSTTGKMCQYCT 59 79**********************************************986 PP | |||||||
2 | K-box | 77.2 | 4.1e-26 | 73 | 169 | 3 | 98 |
K-box 3 kssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 k +g+ e+ + e+l++ela L+ke++ Lq + R++ Ged++s+ ++eL qLe++Le+s+ k+R++Knell +q+++l++ke+ l+een Gorai.012G134200.3 73 KVTGTCiPEHDNREHLYNELAVLRKETRRLQLSMRRYTGEDMSSIPFEELDQLEHELERSVIKVRERKNELLQQQLDNLRRKERILEEENS 163 5555555677899*****************************************************************************9 PP K-box 93 aLrkkl 98 ++ + + Gorai.012G134200.3 164 NMYRWV 169 987765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.081 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-30 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.74E-40 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-23 | 81 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.571 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRGKIPIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFST TGKMCQYCTE 60 GYRMEQIIER YQKVTGTCIP EHDNREHLYN ELAVLRKETR RLQLSMRRYT GEDMSSIPFE 120 ELDQLEHELE RSVIKVRERK NELLQQQLDN LRRKERILEE ENSNMYRWVQ EHRAAIEYQQ 180 GGMEAKPVEH QQVVDQFSFF GEPSSVLQLA TIPQQFQSYQ LQLAQPNLQD SNV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_B | 4e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_C | 4e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_D | 4e-18 | 1 | 71 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM236443 | 0.0 | HM236443.1 Gossypium hirsutum MADS27 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012459843.1 | 1e-173 | PREDICTED: protein TRANSPARENT TESTA 16-like | ||||
Refseq | XP_016679920.1 | 1e-173 | PREDICTED: protein TRANSPARENT TESTA 16-like | ||||
Swissprot | Q8RYD9 | 6e-96 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A0D2TP00 | 1e-172 | A0A0D2TP00_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8IP79 | 1e-172 | A0A1U8IP79_GOSHI; protein TRANSPARENT TESTA 16-like | ||||
STRING | EOX99096 | 1e-162 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-91 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.012G134200.3 |
Entrez Gene | 105780198 |