PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.012G042600.8 | ||||||||
Common Name | B456_012G042600 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 174aa MW: 19951.2 Da PI: 10.4348 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.1 | 8.3e-32 | 24 | 73 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Gorai.012G042600.8 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 73 79***********************************************8 PP | |||||||
2 | K-box | 72.7 | 1e-24 | 93 | 161 | 5 | 73 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 + s++ea+ + +qqe++kL+++i+ q+ +Rh+lGe L+sL++keL++Le +Lek++ +iRskK +l Gorai.012G042600.8 93 TPGSVAEANIQFYQQEATKLRRQIRDVQNMNRHILGEALSSLTFKELKNLEGRLEKGICRIRSKKVFVL 161 445699***********************************************************7666 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-42 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.132 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.88E-33 | 17 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.73E-44 | 17 | 90 | No hit | No description |
PRINTS | PR00404 | 2.0E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.0E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.2E-18 | 101 | 158 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 9.985 | 102 | 173 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MEFPNLDPES SSQKKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSSRGRLY EYANNSVRAT IERYKKACSD ATTPGSVAEA NIQFYQQEAT KLRRQIRDVQ 120 NMNRHILGEA LSSLTFKELK NLEGRLEKGI CRIRSKKVFV LVYIKIFHPF LLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF202091 | 0.0 | EF202091.1 Gossypium hirsutum MADS-box protein MADS7 mRNA, complete cds, alternatively spliced. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016751324.1 | 1e-114 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_016751326.1 | 1e-114 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X3 | ||||
Swissprot | P29381 | 1e-90 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
TrEMBL | A0A0D2RX19 | 1e-124 | A0A0D2RX19_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.012G042600.1 | 1e-114 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 6e-93 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.012G042600.8 |
Publications ? help Back to Top | |||
---|---|---|---|
|