PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.012G011700.1 | ||||||||
Common Name | B456_012G011700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 243aa MW: 27947.9 Da PI: 9.5071 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.4 | 8e-19 | 83 | 130 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +l+++++ +G ++W+tIa++ g++R++k+c++rw +yl Gorai.012G011700.1 83 KGAWTSEEDTKLAEVIAVHGAKSWNTIASKAGLKRCGKSCRLRWMNYL 130 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.5 | 2.4e-16 | 136 | 181 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gorai.012G011700.1 136 RGNISEQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 181 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.735 | 78 | 130 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-29 | 81 | 177 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-14 | 82 | 132 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-17 | 83 | 130 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-24 | 84 | 137 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.23E-9 | 85 | 130 | No hit | No description |
PROSITE profile | PS51294 | 26.066 | 131 | 185 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-16 | 135 | 183 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-15 | 136 | 181 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-25 | 138 | 186 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.09E-10 | 140 | 181 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
YTFCFWCKLL KYGAKLSVYI IEVVVEVILS LKQATQSLDD PSLRPHSSSN LYRLSNHTYP 60 ILETIMGVKK ERPVSSKRSQ INKGAWTSEE DTKLAEVIAV HGAKSWNTIA SKAGLKRCGK 120 SCRLRWMNYL RPNIKRGNIS EQEEDLILRL HKLLGNRWSL IAGRLPGRTD NEIKNYWNSH 180 LSKKIKQKEK QGCKDEKRSV ENGKEELRQE NTCAAGGEDS NISFDVDEFF DFSDEKFEWM 240 NR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-29 | 83 | 185 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF034131 | 1e-121 | AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016718979.1 | 1e-171 | PREDICTED: transcription factor MYB23-like | ||||
Swissprot | Q9SEI0 | 6e-54 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A0D2V091 | 1e-179 | A0A0D2V091_GOSRA; Uncharacterized protein (Fragment) | ||||
STRING | Gorai.012G011700.1 | 1e-180 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 8e-53 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.012G011700.1 |