PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.011G189100.1 | ||||||||
Common Name | B456_011G189100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 129aa MW: 14212.2 Da PI: 6.5949 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 158.8 | 8.7e-50 | 17 | 105 | 2 | 90 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvtseasdkc++e+rkting+d++walatlGf+dy++pl+ yl+k Gorai.011G189100.1 17 REQDRLLPIANVGRIMKQMLPPNAKISKEAKETMQECVSEFISFVTSEASDKCRKERRKTINGEDICWALATLGFDDYAAPLRRYLNKL 105 89************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.0E-49 | 12 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.52E-37 | 19 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-28 | 22 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-16 | 50 | 68 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-16 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 1.3E-16 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MAENVGGSGS NDDDGFREQD RLLPIANVGR IMKQMLPPNA KISKEAKETM QECVSEFISF 60 VTSEASDKCR KERRKTINGE DICWALATLG FDDYAAPLRR YLNKLITTTV MKASMIGSSR 120 NSNLGPFD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-42 | 17 | 104 | 2 | 89 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-42 | 17 | 104 | 2 | 89 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012453013.1 | 2e-73 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_016700599.1 | 2e-73 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O82248 | 5e-51 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0D2TAA9 | 1e-90 | A0A0D2TAA9_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.011G189100.1 | 2e-91 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-53 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.011G189100.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|